PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ZD4VN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 149aa    MW: 17409.9 Da    PI: 9.8736
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ZD4VNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-311870254
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                 prlrWtpeLHe+Fveave+LGG++kAtPk+il+ m vkgL ++h+kSHLQ+YR
  Araip.ZD4VN 18 PRLRWTPELHEQFVEAVESLGGKHKATPKQILQQMAVKGLRIAHIKSHLQMYR 70
                 8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3731474IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-281571IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-231871IPR006447Myb domain, plants
SuperFamilySSF466891.58E-141871IPR009057Homeodomain-like
PfamPF002492.2E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MRNWEKIGVR QYNKSELPRL RWTPELHEQF VEAVESLGGK HKATPKQILQ QMAVKGLRIA  60
HIKSHLQMYR NLKGHASLSV DHLMEEYQHV KDLKITSIPS PKRSSIVTNL RGSNYERRIP  120
MEDLHLSNGV SQISEETDYD LNQILRDSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016165630.11e-103PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_016165631.11e-103PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLK7KBA01e-50K7KBA0_SOYBN; Uncharacterized protein
STRINGGLYMA02G45231.13e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.16e-27G2-like family protein